Lineage for d1bj7a_ (1bj7 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2071991Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2072121Protein Lipocalin allergen [50824] (2 species)
  7. 2072122Species Cow (Bos taurus), bos d 2 [TaxId:9913] [50825] (3 PDB entries)
  8. 2072124Domain d1bj7a_: 1bj7 A: [27113]

Details for d1bj7a_

PDB Entry: 1bj7 (more details), 1.8 Å

PDB Description: bovine lipocalin allergen bos d 2
PDB Compounds: (A:) d 2

SCOPe Domain Sequences for d1bj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bj7a_ b.60.1.1 (A:) Lipocalin allergen {Cow (Bos taurus), bos d 2 [TaxId: 9913]}
idpskipgewriiyaaadnkdkiveggplrnyyrriecindceslsitfylkdqgtclll
tevakrqegyvyvlefygtntlevihvsenmlvtyvenydgeritkmteglakgtsftpe
elekyqqlnsergvpnenienliktdncpp

SCOPe Domain Coordinates for d1bj7a_:

Click to download the PDB-style file with coordinates for d1bj7a_.
(The format of our PDB-style files is described here.)

Timeline for d1bj7a_: