Lineage for d1bj5_3 (1bj5 389-584)
- Root: SCOP 1.71
Class a: All alpha proteins [46456] (226 folds) 
Fold a.126: Serum albumin-like [48551] (1 superfamily)
multihelical; one domain consists of two similar disulfide-linked subdomainsSuperfamily a.126.1: Serum albumin-like [48552] (1 family) 
Family a.126.1.1: Serum albumin-like [48553] (2 proteins) Protein Serum albumin [48554] (1 species)
duplication: consists of three domains of this foldSpecies Human (Homo sapiens) [TaxId:9606] [48555] (26 PDB entries) 
Domain d1bj5_3: 1bj5 389-584 [19371]
complexed with myr
Details for d1bj5_3
PDB Entry: 1bj5 (more details), 2.5 Å
PDB Description: human serum albumin complexed with myristic acid
SCOP Domain Sequences for d1bj5_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bj5_3 a.126.1.1 (389-584) Serum albumin {Human (Homo sapiens)}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaalg
SCOP Domain Coordinates for d1bj5_3:
Click to download the PDB-style file with coordinates for d1bj5_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bj5_3:
- d1bj5_3 first appeared (with stable ids) in SCOP 1.55
- d1bj5_3 appears in SCOP 1.69
- d1bj5_3 is called d1bj5a3 in SCOP 1.73
- d1bj5_3 appears in the current release, SCOPe 2.08, called d1bj5a3
View in 3D
