Lineage for d1bj3a_ (1bj3 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual foldSuperfamily d.169.1: C-type lectin-like [56436] (9 families) 
Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
Pfam PF00059
Protein Snake coagglutinin alpha chain [88861] (10 species)
heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (6 PDB entries) 
Domain d1bj3a_: 1bj3 A: [42341]
Other proteins in same PDB: d1bj3b_
complexed with ca
Details for d1bj3a_
PDB Entry: 1bj3 (more details), 2.6 Å
PDB Description: crystal structure of coagulation factor ix-binding protein (ix-bp) from venom of habu snake with a heterodimer of c-type lectin domains
PDB Compounds: (A:) protein (coagulation factor ix-binding protein a)SCOPe Domain Sequences for d1bj3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bj3a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
qqnpfvcea
SCOPe Domain Coordinates for d1bj3a_:
Click to download the PDB-style file with coordinates for d1bj3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bj3a_:
- d1bj3a_ first appeared (with stable ids) in SCOP 1.55
- d1bj3a_ appears in SCOPe 2.07
View in 3D
