![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.1: Kringle modules [57441] (7 proteins) |
![]() | Protein NK1 fragment of hepatocyte growth factor [57457] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57458] (18 PDB entries) |
![]() | Domain d1bhta2: 1bht A:127-210 [44663] Other proteins in same PDB: d1bhta1, d1bhtb1 complexed with epe, so4 |
PDB Entry: 1bht (more details), 2 Å
SCOPe Domain Sequences for d1bhta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bhta2 g.14.1.1 (A:127-210) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} nciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeegg pwcftsnpevryevcdipqcseve
Timeline for d1bhta2: