Lineage for d1bhta2 (1bht A:127-210)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033286Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 3033287Species Human (Homo sapiens) [TaxId:9606] [57458] (20 PDB entries)
  8. 3033300Domain d1bhta2: 1bht A:127-210 [44663]
    Other proteins in same PDB: d1bhta1, d1bhtb1
    complexed with epe, so4

Details for d1bhta2

PDB Entry: 1bht (more details), 2 Å

PDB Description: nk1 fragment of human hepatocyte growth factor
PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d1bhta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhta2 g.14.1.1 (A:127-210) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
nciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeegg
pwcftsnpevryevcdipqcseve

SCOPe Domain Coordinates for d1bhta2:

Click to download the PDB-style file with coordinates for d1bhta2.
(The format of our PDB-style files is described here.)

Timeline for d1bhta2:

3033300
d1bhta2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1bhta1