Lineage for d1bh4a_ (1bh4 A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2257315Superfamily g.3.3: Cyclotides [57038] (4 families) (S)
    macrocyclic plant knottins closed with the formation of an Asn-Gly peptide
  5. 2257347Family g.3.3.3: Circulin A [57045] (2 proteins)
    automatically mapped to Pfam PF03784
  6. 2257348Protein Circulin A [57046] (1 species)
    cyclic 30-residue polypeptide
  7. 2257349Species Chassalia parviflora [TaxId:58431] [57047] (1 PDB entry)
  8. 2257350Domain d1bh4a_: 1bh4 A: [44079]
    by homology with the Kalata B1 linear precursor, the mature protein sequence probably begins at Gly28 and ends at Asn27

Details for d1bh4a_

PDB Entry: 1bh4 (more details)

PDB Description: circulin a from chassalia parviflora, nmr, 12 structures
PDB Compounds: (A:) circulin a

SCOPe Domain Sequences for d1bh4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bh4a_ g.3.3.3 (A:) Circulin A {Chassalia parviflora [TaxId: 58431]}
cgescvwipcisaalgcscknkvcyrngip

SCOPe Domain Coordinates for d1bh4a_:

Click to download the PDB-style file with coordinates for d1bh4a_.
(The format of our PDB-style files is described here.)

Timeline for d1bh4a_: