Lineage for d1bgka_ (1bgk A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891598Fold g.19: Crisp domain-like [57545] (1 superfamily)
    disulfide-rich all-alpha fold
  4. 891599Superfamily g.19.1: Crisp domain-like [57546] (2 families) (S)
  5. 891600Family g.19.1.1: Sea anemone toxin k [57547] (1 protein)
  6. 891601Protein Sea anemone toxin k [57548] (2 species)
  7. 891602Species Sea anemone (Bunodosoma granulifera), BGK [TaxId:31164] [57549] (1 PDB entry)
  8. 891603Domain d1bgka_: 1bgk A: [44875]

Details for d1bgka_

PDB Entry: 1bgk (more details)

PDB Description: sea anemone toxin (bgk) with high affinity for voltage dependent potassium channel, nmr, 15 structures
PDB Compounds: (A:) bgk

SCOP Domain Sequences for d1bgka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgka_ g.19.1.1 (A:) Sea anemone toxin k {Sea anemone (Bunodosoma granulifera), BGK [TaxId: 31164]}
vcrdwfketacrhakslgncrtsqkyrancaktcelc

SCOP Domain Coordinates for d1bgka_:

Click to download the PDB-style file with coordinates for d1bgka_.
(The format of our PDB-style files is described here.)

Timeline for d1bgka_: