Lineage for d1bg5a1 (1bg5 A:81-254)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) Protein Class alpha GST [81349] (8 species) 
Species Schistosoma japonicum [TaxId:6182] [47633] (15 PDB entries)
Uniprot P08515
Domain d1bg5a1: 1bg5 A:81-254 [17723]
Other proteins in same PDB: d1bg5a2
fused with ankyrin binding domain of alpha-Na,K-ATPase
Details for d1bg5a1
PDB Entry: 1bg5 (more details), 2.6 Å
PDB Description: crystal structure of the ankyrin binding domain of alpha-na,k-atpase as a fusion protein with glutathione s-transferase
PDB Compounds: (A:) fusion protein of alpha-na,k-ATPase with glutathione s-transferaseSCOPe Domain Sequences for d1bg5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bg5a1 a.45.1.1 (A:81-254) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhppksdlvprgssyyqeaksskimesfknmvpqqalvnss
SCOPe Domain Coordinates for d1bg5a1:
Click to download the PDB-style file with coordinates for d1bg5a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bg5a1:
- d1bg5a1 first appeared (with stable ids) in SCOP 1.55, called d1bg5_1
- d1bg5a1 appears in SCOPe 2.06
- d1bg5a1 appears in the current release, SCOPe 2.08
View in 3D
