Lineage for d1bfda1 (1bfd A:182-341)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828384Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 828385Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 828414Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 828438Protein Benzoylformate decarboxylase [52482] (1 species)
  7. 828439Species Pseudomonas putida [TaxId:303] [52483] (9 PDB entries)
    Uniprot P20906
  8. 828446Domain d1bfda1: 1bfd A:182-341 [31745]
    Other proteins in same PDB: d1bfda2, d1bfda3
    complexed with ca, mg, tpp

Details for d1bfda1

PDB Entry: 1bfd (more details), 1.6 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOP Domain Sequences for d1bfda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfda1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

SCOP Domain Coordinates for d1bfda1:

Click to download the PDB-style file with coordinates for d1bfda1.
(The format of our PDB-style files is described here.)

Timeline for d1bfda1: