Lineage for d1befa_ (1bef A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066902Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2066903Protein automated matches [190438] (24 species)
    not a true protein
  7. 2066909Species Dengue virus [TaxId:11060] [311118] (1 PDB entry)
  8. 2066910Domain d1befa_: 1bef A: [302221]
    automated match to d3e90d_

Details for d1befa_

PDB Entry: 1bef (more details), 2.1 Å

PDB Description: crystal structure of dengue virus ns3 serine protease
PDB Compounds: (A:) dengue virus ns3 serine protease

SCOPe Domain Sequences for d1befa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1befa_ b.47.1.0 (A:) automated matches {Dengue virus [TaxId: 11060]}
wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd

SCOPe Domain Coordinates for d1befa_:

Click to download the PDB-style file with coordinates for d1befa_.
(The format of our PDB-style files is described here.)

Timeline for d1befa_: