Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein NS3 protease [50600] (4 species) |
Species Dengue virus type 2 [TaxId:11060] [50602] (3 PDB entries) |
Domain d1befa_: 1bef A: [26419] |
PDB Entry: 1bef (more details), 2.1 Å
SCOP Domain Sequences for d1befa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1befa_ b.47.1.3 (A:) NS3 protease {Dengue virus type 2 [TaxId: 11060]} wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd
Timeline for d1befa_: