Lineage for d1befa_ (1bef A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 803501Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 803502Protein NS3 protease [50600] (4 species)
  7. 803503Species Dengue virus type 2 [TaxId:11060] [50602] (3 PDB entries)
  8. 803505Domain d1befa_: 1bef A: [26419]

Details for d1befa_

PDB Entry: 1bef (more details), 2.1 Å

PDB Description: crystal structure of dengue virus ns3 serine protease
PDB Compounds: (A:) dengue virus ns3 serine protease

SCOP Domain Sequences for d1befa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1befa_ b.47.1.3 (A:) NS3 protease {Dengue virus type 2 [TaxId: 11060]}
wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd

SCOP Domain Coordinates for d1befa_:

Click to download the PDB-style file with coordinates for d1befa_.
(The format of our PDB-style files is described here.)

Timeline for d1befa_: