Lineage for d1beca2 (1bec A:118-246)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294107Protein T-cell antigen receptor [49125] (7 species)
  7. 1294222Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 1294223Domain d1beca2: 1bec A:118-246 [21561]
    Other proteins in same PDB: d1beca1

Details for d1beca2

PDB Entry: 1bec (more details), 1.7 Å

PDB Description: beta chain of a t cell antigen receptor
PDB Compounds: (A:) 14.3.d t cell antigen receptor

SCOPe Domain Sequences for d1beca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1beca2 b.1.1.2 (A:118-246) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad

SCOPe Domain Coordinates for d1beca2:

Click to download the PDB-style file with coordinates for d1beca2.
(The format of our PDB-style files is described here.)

Timeline for d1beca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1beca1