Lineage for d1beca1 (1bec A:3-117)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries) 
Domain d1beca1: 1bec A:3-117 [20627]
Other proteins in same PDB: d1beca2
Details for d1beca1
PDB Entry: 1bec (more details), 1.7 Å
PDB Description: beta chain of a t cell antigen receptor
PDB Compounds: (A:) 14.3.d t cell antigen receptorSCOPe Domain Sequences for d1beca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1beca1 b.1.1.1 (A:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvle
SCOPe Domain Coordinates for d1beca1:
Click to download the PDB-style file with coordinates for d1beca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1beca1:
- d1beca1 first appeared (with stable ids) in SCOP 1.55, called d1bec_1
- d1beca1 appears in SCOPe 2.03
- d1beca1 appears in SCOPe 2.05
- d1beca1 appears in the current release, SCOPe 2.08
View in 3D
