Lineage for d1be4a_ (1be4 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194363Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2194364Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2194374Species Cow (Bos taurus) [TaxId:9913] [54924] (2 PDB entries)
  8. 2194375Domain d1be4a_: 1be4 A: [39090]
    complexed with pcg

Details for d1be4a_

PDB Entry: 1be4 (more details), 2.4 Å

PDB Description: nucleoside diphosphate kinase isoform b from bovine retina
PDB Compounds: (A:) nucleoside diphosphate transferase

SCOPe Domain Sequences for d1be4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be4a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Cow (Bos taurus) [TaxId: 9913]}
ansertfiaikpdgvqrglmgeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svesaekeialwfrpeelvnykscaqnwiye

SCOPe Domain Coordinates for d1be4a_:

Click to download the PDB-style file with coordinates for d1be4a_.
(The format of our PDB-style files is described here.)

Timeline for d1be4a_: