Lineage for d1be4a_ (1be4 A:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) 
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) 
Species Cow (Bos taurus) [TaxId:9913] [54924] (2 PDB entries) 
Domain d1be4a_: 1be4 A: [39090]
complexed with pcg
Details for d1be4a_
PDB Entry: 1be4 (more details), 2.4 Å
PDB Description: nucleoside diphosphate kinase isoform b from bovine retina
PDB Compounds: (A:) nucleoside diphosphate transferaseSCOPe Domain Sequences for d1be4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1be4a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Cow (Bos taurus) [TaxId: 9913]}
ansertfiaikpdgvqrglmgeiikrfeqkgfrlvamkfmrasedllkehyidlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svesaekeialwfrpeelvnykscaqnwiye
SCOPe Domain Coordinates for d1be4a_:
Click to download the PDB-style file with coordinates for d1be4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1be4a_:
- d1be4a_ first appeared (with stable ids) in SCOP 1.55
- d1be4a_ appears in SCOPe 2.02
- d1be4a_ appears in SCOPe 2.04
- d1be4a_ appears in the current release, SCOPe 2.08
View in 3D
