![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
![]() | Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) ![]() can be classified as disulfide-rich |
![]() | Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins) |
![]() | Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species) |
![]() | Species Barley (Hordeum vulgare) [TaxId:4513] [47705] (6 PDB entries) |
![]() | Domain d1be2a_: 1be2 A: [17812] complexed with plm |
PDB Entry: 1be2 (more details)
SCOPe Domain Sequences for d1be2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1be2a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Barley (Hordeum vulgare) [TaxId: 4513]} lncgqvdskmkpcltyvqggpgpsgeccngvrdlhnqaqssgdrqtvcnclkgiargihn lnlnnaasipskcnvnvpytispdidcsriy
Timeline for d1be2a_: