Lineage for d1bdca_ (1bdc A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2696964Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2696965Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 2696966Species Staphylococcus aureus [TaxId:1280] [47000] (27 PDB entries)
  8. 2697062Domain d1bdca_: 1bdc A: [16350]
    domain B

Details for d1bdca_

PDB Entry: 1bdc (more details)

PDB Description: staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, 10 structures
PDB Compounds: (A:) staphylococcus aureus protein a

SCOPe Domain Sequences for d1bdca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdca_ a.8.1.1 (A:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
tadnkfnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqapka

SCOPe Domain Coordinates for d1bdca_:

Click to download the PDB-style file with coordinates for d1bdca_.
(The format of our PDB-style files is described here.)

Timeline for d1bdca_: