Lineage for d1bd8a_ (1bd8 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944478Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1944479Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1944480Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 1944513Protein Cell cycle inhibitor p19ink4D [48409] (2 species)
  7. 1944514Species Human (Homo sapiens) [TaxId:9606] [48410] (2 PDB entries)
  8. 1944515Domain d1bd8a_: 1bd8 A: [19157]

Details for d1bd8a_

PDB Entry: 1bd8 (more details), 1.8 Å

PDB Description: structure of cdk inhibitor p19ink4d
PDB Compounds: (A:) p19ink4d cdk4/6 inhibitor

SCOPe Domain Sequences for d1bd8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]}
ragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqgas
pnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsfl
aaesdlhrrdargltplelalqrgaqdlvdilqghm

SCOPe Domain Coordinates for d1bd8a_:

Click to download the PDB-style file with coordinates for d1bd8a_.
(The format of our PDB-style files is described here.)

Timeline for d1bd8a_: