| Class b: All beta proteins [48724] (174 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
| Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) barrel, closed; n=5, S=10 |
| Protein Lysyl-tRNA synthetase (LysRS) [50256] (3 species) |
| Species Escherichia coli, gene lysS [TaxId:562] [50257] (4 PDB entries) |
| Domain d1bbua1: 1bbu A:11-154 [25254] Other proteins in same PDB: d1bbua2 protein/RNA complex; complexed with lys |
PDB Entry: 1bbu (more details), 2.7 Å
SCOPe Domain Sequences for d1bbua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bbua1 b.40.4.1 (A:11-154) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysS [TaxId: 562]}
vvdlnnelktrreklanlreqgiafpndfrrdhtsdqlhaefdgkeneelealnievava
grmmtrrimgkasfvtlqdvggriqlyvarddlpegvyneqfkkwdlgdilgakgklfkt
ktgelsihctelrlltkalrplpd
Timeline for d1bbua1: