Lineage for d1bbpa_ (1bbp A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957981Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 957982Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 957983Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 958052Protein Bilin-binding protein [50837] (1 species)
  7. 958053Species Cabbage butterfly (Pieris brassicae) [TaxId:7116] [50838] (6 PDB entries)
  8. 958059Domain d1bbpa_: 1bbp A: [27147]
    complexed with blv

Details for d1bbpa_

PDB Entry: 1bbp (more details), 2 Å

PDB Description: molecular structure of the bilin binding protein (bbp) from pieris brassicae after refinement at 2.0 angstroms resolution.
PDB Compounds: (A:) bilin binding protein

SCOPe Domain Sequences for d1bbpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbpa_ b.60.1.1 (A:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]}
nvyhdgacpevkpvdnfdwsnyhgkwwevakypnsvekygkcgwaeytpegksvkvsnyh
vihgkeyfiegtaypvgdskigkiyhkltyggvtkenvfnvlstdnknyiigyyckyded
kkghqdfvwvlsrskvltgeaktavenyligspvvdsqklvysdfseaackvn

SCOPe Domain Coordinates for d1bbpa_:

Click to download the PDB-style file with coordinates for d1bbpa_.
(The format of our PDB-style files is described here.)

Timeline for d1bbpa_: