![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
![]() | Protein Bilin-binding protein [50837] (1 species) |
![]() | Species Cabbage butterfly (Pieris brassicae) [TaxId:7116] [50838] (6 PDB entries) |
![]() | Domain d1bbpa_: 1bbp A: [27147] complexed with blv |
PDB Entry: 1bbp (more details), 2 Å
SCOPe Domain Sequences for d1bbpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bbpa_ b.60.1.1 (A:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]} nvyhdgacpevkpvdnfdwsnyhgkwwevakypnsvekygkcgwaeytpegksvkvsnyh vihgkeyfiegtaypvgdskigkiyhkltyggvtkenvfnvlstdnknyiigyyckyded kkghqdfvwvlsrskvltgeaktavenyligspvvdsqklvysdfseaackvn
Timeline for d1bbpa_: