Lineage for d1bbha_ (1bbh A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2312848Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2313134Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 2313135Protein Cytochrome c' [47180] (9 species)
  7. 2313161Species Chromatium vinosum [TaxId:1049] [47182] (1 PDB entry)
  8. 2313162Domain d1bbha_: 1bbh A: [16546]
    complexed with hem

Details for d1bbha_

PDB Entry: 1bbh (more details), 1.8 Å

PDB Description: atomic structure of a cytochrome c' with an unusual ligand-controlled dimer dissociation at 1.8 angstroms resolution
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d1bbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbha_ a.24.3.2 (A:) Cytochrome c' {Chromatium vinosum [TaxId: 1049]}
aglspeeqietrqagyefmgwnmgkikanlegeynaaqveaaanviaaiansgmgalygp
gtdknvgdvktrvkpeffqnmedvgkiarefvgaantlaevaatgeaeavktafgdvgaa
ckschekyrak

SCOPe Domain Coordinates for d1bbha_:

Click to download the PDB-style file with coordinates for d1bbha_.
(The format of our PDB-style files is described here.)

Timeline for d1bbha_:

2313162
d1bbha_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1bbhb_