Lineage for d1bala_ (1bal A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697346Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 2697347Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 2697348Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (4 proteins)
  6. Protein E3-binding domain of dihydrolipoamide succinyltransferase [47009] (1 species)
  7. Species Escherichia coli [TaxId:562] [47010] (3 PDB entries)
  8. 2697356Domain d1bala_: 1bal A: [16357]

Details for d1bala_

PDB Entry: 1bal (more details)

PDB Description: three-dimensional solution structure of the e3-binding domain of the dihydrolipoamide succinyltransferase core from the 2-oxoglutarate dehydrogenase multienzyme complex of (escherichia coli)
PDB Compounds: (A:) dihydrolipoamide succinyltransferase

SCOPe Domain Sequences for d1bala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bala_ a.9.1.1 (A:) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]}
yasleeqnndalspairrllaehnldasaikgtgvggrltredvekhlaka

SCOPe Domain Coordinates for d1bala_:

Click to download the PDB-style file with coordinates for d1bala_.
(The format of our PDB-style files is described here.)

Timeline for d1bala_: