Lineage for d1baga2 (1bag A:1-347)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
Protein Bacterial alpha-amylase [51447] (10 species) 
Species Bacillus subtilis [TaxId:1423] [51450] (2 PDB entries)
Uniprot P00691
Domain d1baga2: 1bag A:1-347 [28707]
Other proteins in same PDB: d1baga1
complexed with ca
Details for d1baga2
PDB Entry: 1bag (more details), 2.5 Å
PDB Description: alpha-amylase from bacillus subtilis complexed with maltopentaose
PDB Compounds: (A:) alpha-1,4-glucan-4-glucanohydrolaseSCOPe Domain Sequences for d1baga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1baga2 c.1.8.1 (A:1-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]}
ltapsiksgtilhawnwsfntlkhnmkdihdagytaiqtspinqvkegnqgdksmsnwyw
lyqptsyqignrylgteqefkemcaaaeeygikvivdavinhttfdyaaisnevksipnw
thgntqiknwsdrwdvtqnsllglydwntqntqvqsylkrfleralndgadgfrfdaakh
ielpddgsygsqfwpnitntsaefqygqilqdsasrdaayanymdvtasnyghsirsalk
nrnlgvsnishyasdvsadklvtwveshdtyanddeestwmsdddirlgwaviasrsgst
plffsrpegggngvrfpgksqigdrgsalfedqaitavnrfhnvmag
SCOPe Domain Coordinates for d1baga2:
Click to download the PDB-style file with coordinates for d1baga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1baga2:
- d1baga2 first appeared (with stable ids) in SCOP 1.55, called d1bag_2
- d1baga2 appears in SCOPe 2.05
- d1baga2 appears in SCOPe 2.07
- d1baga2 appears in the current release, SCOPe 2.08
View in 3D
