Lineage for d1ba7a_ (1ba7 A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.4: STI-like [50386] (3 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
automatically mapped to Pfam PF00197Protein Soybean trypsin inhibitor [50394] (1 species) Species Soybean (Glycine max) [TaxId:3847] [50395] (4 PDB entries) 
Domain d1ba7a_: 1ba7 A: [25601]
Details for d1ba7a_
PDB Entry: 1ba7 (more details), 2.5 Å
PDB Description: soybean trypsin inhibitor
PDB Compounds: (A:) trypsin inhibitor (kunitz)SCOPe Domain Sequences for d1ba7a_:
Sequence, based on SEQRES records: (download)
>d1ba7a_ b.42.4.1 (A:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkl
Sequence, based on observed residues (ATOM records): (download)
>d1ba7a_ b.42.4.1 (A:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervnnyklvfcpqcgdigisidhddgtrrlvvsknkplvvqfqkl
SCOPe Domain Coordinates for d1ba7a_:
Click to download the PDB-style file with coordinates for d1ba7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ba7a_:
- d1ba7a_ first appeared (with stable ids) in SCOP 1.55
- d1ba7a_ appears in SCOPe 2.07
View in 3D
