Lineage for d1b90a2 (1b90 A:1-417)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682153Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 682303Protein Bacterial beta-amylase [51485] (1 species)
    protein contains additional starch-binding domain
  7. 682304Species Bacillus cereus [TaxId:1396] [51486] (14 PDB entries)
  8. 682336Domain d1b90a2: 1b90 A:1-417 [28803]
    Other proteins in same PDB: d1b90a1
    complexed with act, ca, so4

Details for d1b90a2

PDB Entry: 1b90 (more details), 2.5 Å

PDB Description: bacillus cereus beta-amylase apo form
PDB Compounds: (A:) protein (beta-amylase)

SCOP Domain Sequences for d1b90a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b90a2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]}
avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgv

SCOP Domain Coordinates for d1b90a2:

Click to download the PDB-style file with coordinates for d1b90a2.
(The format of our PDB-style files is described here.)

Timeline for d1b90a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b90a1