Lineage for d1b8aa1 (1b8a A:1-103)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
barrel, closed; n=5, S=10
Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes
Species Pyrococcus kodakaraensis [TaxId:311400] [50253] (1 PDB entry) 
Domain d1b8aa1: 1b8a A:1-103 [25244]
Other proteins in same PDB: d1b8aa2, d1b8ab2
complexed with atp, mn
Details for d1b8aa1
PDB Entry: 1b8a (more details), 1.9 Å
PDB Description: aspartyl-trna synthetase
PDB Compounds: (A:) protein (aspartyl-tRNA synthetase)SCOPe Domain Sequences for d1b8aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8aa1 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS) {Pyrococcus kodakaraensis [TaxId: 311400]}
myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf
klipklrsedvvavegvvnftpkaklgfeilpekivvlnraet
SCOPe Domain Coordinates for d1b8aa1:
Click to download the PDB-style file with coordinates for d1b8aa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b8aa1:
- d1b8aa1 first appeared (with stable ids) in SCOP 1.55
- d1b8aa1 appears in SCOPe 2.07
View in 3D
