Lineage for d1b87a_ (1b87 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731000Protein Aminoglycoside 6'-N-acetyltransferase [55731] (1 species)
  7. 731001Species Enterococcus faecium [TaxId:1352] [55732] (3 PDB entries)
  8. 731008Domain d1b87a_: 1b87 A: [40797]
    complexed with aco; mutant

Details for d1b87a_

PDB Entry: 1b87 (more details), 2.7 Å

PDB Description: crystal structure of an aminoglycoside 6'-n-acetyltransferase
PDB Compounds: (A:) protein (aminoglycoside n6'-acetyltransferase type 1)

SCOP Domain Sequences for d1b87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b87a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}
miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
s

SCOP Domain Coordinates for d1b87a_:

Click to download the PDB-style file with coordinates for d1b87a_.
(The format of our PDB-style files is described here.)

Timeline for d1b87a_: