Lineage for d1b70b3 (1b70 B:39-151)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541449Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 1541459Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
  7. 1541460Species Thermus thermophilus [TaxId:274] [50279] (11 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1541467Domain d1b70b3: 1b70 B:39-151 [25313]
    Other proteins in same PDB: d1b70a_, d1b70b1, d1b70b2, d1b70b4, d1b70b5, d1b70b6
    protein/RNA complex; complexed with mg, phe

Details for d1b70b3

PDB Entry: 1b70 (more details), 2.7 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalanine
PDB Compounds: (B:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1b70b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b70b3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOPe Domain Coordinates for d1b70b3:

Click to download the PDB-style file with coordinates for d1b70b3.
(The format of our PDB-style files is described here.)

Timeline for d1b70b3: