SCOPe 2.06: Domain d1b70b2: 1b70 B:400-474

Lineage for d1b70b2 (1b70 B:400-474)

Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds)
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)
Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
duplication: contains two such domains related by pseudo dyad
Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries)
identical sequence to Thermus aquaticus, TaxId: 271
Domain d1b70b2: 1b70 B:400-474 [16304]
Other proteins in same PDB: d1b70a_, d1b70b3, d1b70b4, d1b70b5, d1b70b6
protein/RNA complex; complexed with mg, phe

Details for d1b70b2

PDB Entry: 1b70 (more details), 2.7 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalanine

PDB Compounds: (B:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1b70b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b70b2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

SCOPe Domain Coordinates for d1b70b2:

Click to download the PDB-style file with coordinates for d1b70b2.
(The format of our PDB-style files is described here.)

Timeline for d1b70b2: