Lineage for d1b55a_ (1b55 A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helixSuperfamily b.55.1: PH domain-like [50729] (14 families) 
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
Pfam PF00169
Protein Bruton's tyrosine kinase [50738] (1 species)
contains Btk zinc-binding motifSpecies Human (Homo sapiens) [TaxId:9606] [50739] (10 PDB entries) 
Domain d1b55a_: 1b55 A: [26963]
complexed with 4ip, zn
has additional insertions and/or extensions that are not grouped together
Details for d1b55a_
PDB Entry: 1b55 (more details), 2.4 Å
PDB Description: ph domain from bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate
PDB Compounds: (A:) Tyrosine-protein kinase BTKSCOPe Domain Sequences for d1b55a_:
Sequence, based on SEQRES records: (download)
>d1b55a_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen
Sequence, based on observed residues (ATOM records): (download)
>d1b55a_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqiprrmeqisiierfpypfqvvydegplyvfspteelrkrwihq
lknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen
SCOPe Domain Coordinates for d1b55a_:
Click to download the PDB-style file with coordinates for d1b55a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b55a_:
- d1b55a_ first appeared (with stable ids) in SCOP 1.55
- d1b55a_ appears in SCOPe 2.07
View in 3D
