Lineage for d1b50a_ (1b50 A:)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies)
beta(3)-alpha
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) 
form dimers with different dimerisation modesFamily d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) 
Protein Macrophage inflammatory protein, MIP [54128] (5 species)
has different dimerisation mode
Species Human (Homo sapiens), 1-alpha [TaxId:9606] [54130] (3 PDB entries) 
Domain d1b50a_: 1b50 A: [37401]
Details for d1b50a_
PDB Entry: 1b50 (more details)
PDB Description: nmr structure of human mip-1a d26a, 10 structures
PDB Compounds: (A:) mip-1aSCOPe Domain Sequences for d1b50a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b50a_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha [TaxId: 9606]}
slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk
yvsdlelsa
SCOPe Domain Coordinates for d1b50a_:
Click to download the PDB-style file with coordinates for d1b50a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b50a_:
- d1b50a_ first appeared (with stable ids) in SCOP 1.55
- d1b50a_ appears in SCOP 1.75
- d1b50a_ appears in SCOPe 2.02
- d1b50a_ appears in the current release, SCOPe 2.08
View in 3D
