Lineage for d1b4sa_ (1b4s A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1204903Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1204904Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1204905Protein Nucleoside diphosphate kinase, NDK [54921] (21 species)
  7. 1205059Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [54925] (21 PDB entries)
  8. 1205086Domain d1b4sa_: 1b4s A: [39122]
    complexed with adp, mg, po4; mutant

Details for d1b4sa_

PDB Entry: 1b4s (more details), 2.5 Å

PDB Description: structure of nucleoside diphosphate kinase h122g mutant
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1b4sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4sa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
svesanreialwfkpeelltevkpnpnlye

SCOPe Domain Coordinates for d1b4sa_:

Click to download the PDB-style file with coordinates for d1b4sa_.
(The format of our PDB-style files is described here.)

Timeline for d1b4sa_: