Lineage for d1b4ca_ (1b4c A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914095Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 914096Protein Calcyclin (S100) [47479] (17 species)
  7. 914269Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (6 PDB entries)
  8. 914276Domain d1b4ca_: 1b4c A: [17169]

Details for d1b4ca_

PDB Entry: 1b4c (more details)

PDB Description: solution structure of rat apo-s100b using dipolar couplings
PDB Compounds: (A:) protein (s-100 protein, beta chain)

SCOPe Domain Sequences for d1b4ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ca_ a.39.1.2 (A:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b [TaxId: 10116]}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

SCOPe Domain Coordinates for d1b4ca_:

Click to download the PDB-style file with coordinates for d1b4ca_.
(The format of our PDB-style files is described here.)

Timeline for d1b4ca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b4cb_