Lineage for d1b44d_ (1b44 D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2058420Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2058565Protein Heat-labile toxin [50205] (2 species)
  7. 2058566Species Escherichia coli, type IB [TaxId:562] [50206] (22 PDB entries)
  8. 2058702Domain d1b44d_: 1b44 D: [24960]
    extended C-terminally with a peptide with anti-hsv activity

Details for d1b44d_

PDB Entry: 1b44 (more details), 3.3 Å

PDB Description: crystal structure of the b subunit of heat-labile enterotoxin from e. coli carrying a peptide with anti-hsv activity
PDB Compounds: (D:) protein (b-pol subunit of heat-labile enterotoxin)

SCOPe Domain Sequences for d1b44d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b44d_ b.40.2.1 (D:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismeklag

SCOPe Domain Coordinates for d1b44d_:

Click to download the PDB-style file with coordinates for d1b44d_.
(The format of our PDB-style files is described here.)

Timeline for d1b44d_: