Lineage for d1b3sa_ (1b3s A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 713695Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 713696Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 713697Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)
  6. 713698Protein Barnase [81305] (1 species)
  7. 713699Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (43 PDB entries)
  8. 713814Domain d1b3sa_: 1b3s A: [36229]
    Other proteins in same PDB: d1b3sd_, d1b3se_, d1b3sf_

Details for d1b3sa_

PDB Entry: 1b3s (more details), 2.39 Å

PDB Description: structural response to mutation at a protein-protein interface
PDB Compounds: (A:) protein (barnase)

SCOP Domain Sequences for d1b3sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3sa_ d.1.1.2 (A:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir

SCOP Domain Coordinates for d1b3sa_:

Click to download the PDB-style file with coordinates for d1b3sa_.
(The format of our PDB-style files is described here.)

Timeline for d1b3sa_: