Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Stromelysin-1 (MMP-3) [55536] (1 species) |
Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (40 PDB entries) |
Domain d1b3db_: 1b3d B: [40383] complexed with ca, s27, zn |
PDB Entry: 1b3d (more details), 2.3 Å
SCOPe Domain Sequences for d1b3db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3db_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet
Timeline for d1b3db_: