Lineage for d1b1xa2 (1b1x A:334-689)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163256Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2163257Protein Lactoferrin [53889] (6 species)
  7. 2163295Species Horse (Equus caballus) [TaxId:9796] [53893] (7 PDB entries)
  8. 2163297Domain d1b1xa2: 1b1x A:334-689 [35866]
    complexed with co3, fe

Details for d1b1xa2

PDB Entry: 1b1x (more details), 2.62 Å

PDB Description: structure of diferric mare lactoferrin at 2.62a resolution
PDB Compounds: (A:) lactoferrin

SCOPe Domain Sequences for d1b1xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b1xa2 c.94.1.2 (A:334-689) Lactoferrin {Horse (Equus caballus) [TaxId: 9796]}
taaevaarrervvwcavgpeeerkckqwsdvsnrkvacasastteecialvlkgeadaln
ldggfiyvagkcglvpvlaenqksqnsnapdcvhrppegylavavvrksdadltwnslsg
kkschtgvgrtaawnipmgllfnqtgsckfdkffsqscapgadpqsslcalcvgnnenen
kcmpnseeryygytgafrclaekagdvafvkdvtvlqntdgknsepwakdlkqedfellc
ldgtrkpvaeaeschlarapnhavvsqsdraqhlkkvlflqqdqfggngpdcpgkfclfk
setknllfndnteclaelqgkttyeqylgseyvtsitnlrrcsssplleacaflra

SCOPe Domain Coordinates for d1b1xa2:

Click to download the PDB-style file with coordinates for d1b1xa2.
(The format of our PDB-style files is described here.)

Timeline for d1b1xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b1xa1