Lineage for d1b1ba2 (1b1b A:65-140)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644361Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 644362Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 644363Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 644396Protein Iron-dependent regulator [47983] (1 species)
  7. 644397Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)
  8. 644420Domain d1b1ba2: 1b1b A:65-140 [18421]
    Other proteins in same PDB: d1b1ba1

Details for d1b1ba2

PDB Entry: 1b1b (more details), 2.6 Å

PDB Description: iron dependent regulator
PDB Compounds: (A:) protein (iron dependent regulator)

SCOP Domain Sequences for d1b1ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b1ba2 a.76.1.1 (A:65-140) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipglvelgv

SCOP Domain Coordinates for d1b1ba2:

Click to download the PDB-style file with coordinates for d1b1ba2.
(The format of our PDB-style files is described here.)

Timeline for d1b1ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b1ba1