Lineage for d1b1ba2 (1b1b A:65-140)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
6 helices, homodimer of 3-helical domainsSuperfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) 
automatically mapped to Pfam PF02742Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) 
Protein Iron-dependent regulator [47983] (1 species) Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)
Uniprot Q50495
Domain d1b1ba2: 1b1b A:65-140 [18421]
Other proteins in same PDB: d1b1ba1
complexed with so4, zn
Details for d1b1ba2
PDB Entry: 1b1b (more details), 2.6 Å
PDB Description: iron dependent regulator
PDB Compounds: (A:) protein (iron dependent regulator)SCOPe Domain Sequences for d1b1ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b1ba2 a.76.1.1 (A:65-140) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipglvelgv
SCOPe Domain Coordinates for d1b1ba2:
Click to download the PDB-style file with coordinates for d1b1ba2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b1ba2:
- d1b1ba2 first appeared (with stable ids) in SCOP 1.55
- d1b1ba2 appears in SCOPe 2.07
View in 3D
