Lineage for d1b10a_ (1b10 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890617Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1890618Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1890619Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1890620Protein Prion protein domain [54100] (14 species)
  7. 1890636Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [54102] (1 PDB entry)
  8. 1890637Domain d1b10a_: 1b10 A: [37306]

Details for d1b10a_

PDB Entry: 1b10 (more details)

PDB Description: solution nmr structure of recombinant syrian hamster prion protein rprp(90-231) , 25 structures
PDB Compounds: (A:) protein (prion protein)

SCOPe Domain Sequences for d1b10a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b10a_ d.6.1.1 (A:) Prion protein domain {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
lggymlgsamsrpmmhfgndwedryyrenmnrypnqvyyrpvdqynnqnnfvhdcvniti
kqhtvttttkgenftetdikimervveqmcttqyqkesqayydg

SCOPe Domain Coordinates for d1b10a_:

Click to download the PDB-style file with coordinates for d1b10a_.
(The format of our PDB-style files is described here.)

Timeline for d1b10a_: