Lineage for d1b0ua_ (1b0u A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1596847Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1596854Protein ATP-binding subunit of the histidine permease [52687] (1 species)
  7. 1596855Species Salmonella typhimurium [TaxId:90371] [52688] (1 PDB entry)
  8. 1596856Domain d1b0ua_: 1b0u A: [32370]
    complexed with atp, cl

Details for d1b0ua_

PDB Entry: 1b0u (more details), 1.5 Å

PDB Description: atp-binding subunit of the histidine permease from salmonella typhimurium
PDB Compounds: (A:) histidine permease

SCOPe Domain Sequences for d1b0ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}
nklhvidlhkrygghevlkgvslqaragdvisiigssgsgkstflrcinflekpsegaii
vngqninlvrdkdgqlkvadknqlrllrtrltmvfqhfnlwshmtvlenvmeapiqvlgl
skhdareralkylakvgideraqgkypvhlsggqqqrvsiaralamepdvllfdeptsal
dpelvgevlrimqqlaeegktmvvvthemgfarhvsshviflhqgkieeegdpeqvfgnp
qsprlqqflkgslkkleh

SCOPe Domain Coordinates for d1b0ua_:

Click to download the PDB-style file with coordinates for d1b0ua_.
(The format of our PDB-style files is described here.)

Timeline for d1b0ua_: