Lineage for d1b0oa_ (1b0o A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957981Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 957982Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 957983Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 958006Protein beta-Lactoglobulin [50827] (3 species)
  7. 958007Species Cow (Bos taurus) [TaxId:9913] [50828] (31 PDB entries)
    Uniprot P02754
  8. 958034Domain d1b0oa_: 1b0o A: [27121]
    complexed with plm

Details for d1b0oa_

PDB Entry: 1b0o (more details), 2.5 Å

PDB Description: bovine beta-lactoglobulin complexed with palmitate, lattice z
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d1b0oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0oa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOPe Domain Coordinates for d1b0oa_:

Click to download the PDB-style file with coordinates for d1b0oa_.
(The format of our PDB-style files is described here.)

Timeline for d1b0oa_: