Lineage for d1b08a1 (1b08 A:235-355)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 738241Protein Surfactant protein, lectin domain [56461] (2 species)
  7. 738242Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (8 PDB entries)
  8. 738264Domain d1b08a1: 1b08 A:235-355 [42416]
    Other proteins in same PDB: d1b08a2, d1b08b2, d1b08c2

Details for d1b08a1

PDB Entry: 1b08 (more details), 2.3 Å

PDB Description: lung surfactant protein d (sp-d) (fragment)
PDB Compounds: (A:) protein (lung surfactant protein d)

SCOP Domain Sequences for d1b08a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b08a1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOP Domain Coordinates for d1b08a1:

Click to download the PDB-style file with coordinates for d1b08a1.
(The format of our PDB-style files is described here.)

Timeline for d1b08a1:

738264
d1b08a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1b08a2