Lineage for d1b00a_ (1b00 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2463696Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2463851Protein PhoB receiver domain [52192] (2 species)
  7. 2463852Species Escherichia coli [TaxId:562] [52193] (1 PDB entry)
  8. 2463853Domain d1b00a_: 1b00 A: [31122]

Details for d1b00a_

PDB Entry: 1b00 (more details), 1.88 Å

PDB Description: phob receiver domain from escherichia coli
PDB Compounds: (A:) phosphate regulon transcriptional regulatory protein phob

SCOPe Domain Sequences for d1b00a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b00a_ c.23.1.1 (A:) PhoB receiver domain {Escherichia coli [TaxId: 562]}
arrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsg
iqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmr
ri

SCOPe Domain Coordinates for d1b00a_:

Click to download the PDB-style file with coordinates for d1b00a_.
(The format of our PDB-style files is described here.)

Timeline for d1b00a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b00b_