Lineage for d1azwa_ (1azw A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.7: Proline iminopeptidase-like [53509] (4 proteins) 
Protein Proline iminopeptidase [53510] (1 species) Species Xanthomonas campestris, pv. citri [TaxId:339] [53511] (1 PDB entry) 
Domain d1azwa_: 1azw A: [34658]
Details for d1azwa_
PDB Entry: 1azw (more details), 2.7 Å
PDB Description: proline iminopeptidase from xanthomonas campestris pv. citri
PDB Compounds: (A:) proline iminopeptidaseSCOPe Domain Sequences for d1azwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]}
mrtlypeitpyqqgslkvddrhtlyfeqcgnphgkpvvmlhggpgggcndkmrrfhdpak
yrivlfdqrgsgrstphadlvdnttwdlvadierlrthlgvdrwqvfggswgstlalaya
qthpqqvtelvlrgifllrrfelewfyqegasrlfpdawehylnaippveradlmsafhr
rltsddeatrlaaakawsvwegatsflhvdedfvtghedahfalafarienhyfvnggff
evedqllrdahriadipgvivhgrydvvcplqsawdlhkawpkaqlqispasghsafepe
nvdalvratdgfa
SCOPe Domain Coordinates for d1azwa_:
Click to download the PDB-style file with coordinates for d1azwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1azwa_:
- d1azwa_ first appeared (with stable ids) in SCOP 1.55
- d1azwa_ appears in SCOPe 2.05
- d1azwa_ appears in SCOPe 2.07
- d1azwa_ appears in the current release, SCOPe 2.08
View in 3D
