Lineage for d1azsc2 (1azs C:36-66,C:202-393)
- Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (78 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein Transducin (alpha subunit) [52623] (3 species)
common fold is interrupted with an all-alpha domain
Species Cow (Bos taurus) [TaxId:9913] [52624] (15 PDB entries) 
Domain d1azsc2: 1azs C:36-66,C:202-393 [32086]
Other proteins in same PDB: d1azsa_, d1azsb_, d1azsc1
complexed with fkp, gsp, mg; mutant
Details for d1azsc2
PDB Entry: 1azs (more details), 2.3 Å
PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase
PDB Compounds: (C:) gs-alphaSCOP Domain Sequences for d1azsc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azsc2 c.37.1.8 (C:36-66,C:202-393) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
vyrathrllllgagesgkstivkqmrilhvnXvltsgifetkfqvdkvnfhmfdvggqrd
errkwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvil
flnkqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflris
tasgdgrhycyphftcavdtenirrvfndcrdiiqrmhlrqyel
SCOP Domain Coordinates for d1azsc2:
Click to download the PDB-style file with coordinates for d1azsc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1azsc2:
- d1azsc2 first appeared (with stable ids) in SCOP 1.55
- d1azsc2 appears in SCOP 1.71
- d1azsc2 appears in SCOP 1.75
- d1azsc2 appears in the current release, SCOPe 2.08
View in 3D
