Lineage for d1azi__ (1azi -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531553Protein Myoglobin [46469] (9 species)
  7. 531558Species Horse (Equus caballus) [TaxId:9796] [46474] (20 PDB entries)
  8. 531577Domain d1azi__: 1azi - [15201]
    complexed with azi, hem, so4

Details for d1azi__

PDB Entry: 1azi (more details), 2 Å

PDB Description: myoglobin (horse heart) recombinant wild-type complexed with azide

SCOP Domain Sequences for d1azi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azi__ a.1.1.2 (-) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOP Domain Coordinates for d1azi__:

Click to download the PDB-style file with coordinates for d1azi__.
(The format of our PDB-style files is described here.)

Timeline for d1azi__: