Lineage for d1ayl_2 (1ayl 1-227)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594849Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 594850Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) (S)
  5. 594851Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 594860Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (3 species)
  7. 594861Species Escherichia coli [TaxId:562] [68926] (6 PDB entries)
  8. 594867Domain d1ayl_2: 1ayl 1-227 [64719]
    Other proteins in same PDB: d1ayl_1
    complexed with atp, mg, oxl

Details for d1ayl_2

PDB Entry: 1ayl (more details), 1.8 Å

PDB Description: phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d1ayl_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayl_2 c.109.1.1 (1-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli}
mrvnngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtg
iftgrspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfv
vdafcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqw
keqglnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg

SCOP Domain Coordinates for d1ayl_2:

Click to download the PDB-style file with coordinates for d1ayl_2.
(The format of our PDB-style files is described here.)

Timeline for d1ayl_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ayl_1