Lineage for d1ayja_ (1ayj A:)
- Root: SCOP 1.75
Class g: Small proteins [56992] (90 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) 
Family g.3.7.5: Plant defensins [57170] (8 proteins) 
Protein Antifungal protein 1 (RS-AFP1) [57174] (1 species) Species Radish (Raphanus sativus) [TaxId:3726] [57175] (1 PDB entry) 
Domain d1ayja_: 1ayj A: [44177]
Details for d1ayja_
PDB Entry: 1ayj (more details)
PDB Description: determination of the three-dimensional solution structure of raphanus sativus antifungal protein 1 (rs-afp1) by 1h nmr, 20 structures
PDB Compounds: (A:) antifungal protein 1SCOP Domain Sequences for d1ayja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayja_ g.3.7.5 (A:) Antifungal protein 1 (RS-AFP1) {Radish (Raphanus sativus) [TaxId: 3726]}
eklcerpsgtwsgvcgnnnacknqcinlekarhgscnyvfpahkcicyfpc
SCOP Domain Coordinates for d1ayja_:
Click to download the PDB-style file with coordinates for d1ayja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ayja_:
- d1ayja_ first appeared (with stable ids) in SCOP 1.55, called d1ayj__
- d1ayja_ appears in SCOP 1.73
- d1ayja_ appears in SCOPe 2.01
- d1ayja_ appears in the current release, SCOPe 2.08
View in 3D