Lineage for d1ayfa_ (1ayf A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) 
Protein Adrenodoxin [54310] (1 species) Species Cow (Bos taurus) [TaxId:9913] [54311] (5 PDB entries) 
Domain d1ayfa_: 1ayf A: [37684]
complexed with fes, gol
Details for d1ayfa_
PDB Entry: 1ayf (more details), 1.85 Å
PDB Description: bovine adrenodoxin (oxidized)
PDB Compounds: (A:) adrenodoxinSCOPe Domain Sequences for d1ayfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayfa_ d.15.4.1 (A:) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]}
kitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhife
kleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp
SCOPe Domain Coordinates for d1ayfa_:
Click to download the PDB-style file with coordinates for d1ayfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ayfa_:
- d1ayfa_ first appeared (with stable ids) in SCOP 1.55
- d1ayfa_ appears in SCOPe 2.04
- d1ayfa_ appears in SCOPe 2.06
- d1ayfa_ appears in the current release, SCOPe 2.08
View in 3D
